OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tcf4 (BC014293) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508151
Purified recombinant protein of Mouse transcription factor 4 (cDNA clone MGC:13998 IMAGE:4014231), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA362918 TCF4 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tcf4 or BC014293"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208151 protein sequence
Red=Cloning site Green=Tags(s)

MYCAYTIPGMGGNSLMYYYNGKAVYAPSASTADYNRDSPGYPSSKPAASTFPSSFFMQDGHHSSDPWSSS
SGMNQPGYGGMLGNSSHIPQSSSYCSLHPHERLSYPSHSSADINSSLPPMSTFHRSGTNHYSTSSCTPPA
NGTDSIMANRGTGAAGSSQTGDALGKALASIYSPDHTNNSFSSNPSTPVGSPPSLSAGTAVWSRNGGQAS
SSPNYEGPLHSLQSRIEDRLERLDDAIHVLRNHAVGPSTAVPGGHGDMHGIMGPSHNGAMGSLGSGYGTS
LLSANRHSLMVGAHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGS
SEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITSNNDDEDLTPEQKAEREKERRMANNARERLRVRDI
NEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRREEEKVSSEPPPLSL
AGPHPGMGDAANHMGQM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 21413
UniProt ID Q60722
Cytogenetics 18 E2
RefSeq Size 1765
RefSeq ORF 1521
Synonyms ME2, ITF-2, SEF-2, MITF-2A, MITF-2B, TFE, E2-2, E2.2, ITF2, SEF2, ASP-I2, ITF-2b, SEF2-1
Summary Transcription factor that binds to the immunoglobulin enhancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Isoform 2 inhibits MYOD1 activation of the cardiac alpha-actin promoter. Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription. May have a regulatory function in developmental processes as well as during neuronal plasticity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Pdcd4 knockdown up-regulates MAP4K1 expression and activation of AP-1 dependent transcription through c-Myc
Wang, Zhang, Yang
Biochim. Biophys. Acta (2012) 1823 (10), 1807-14 DOI: 10.1016/j.bbamcr.2012.07.004
Cited by 44
AI Summary: OriGene contributed to this study by providing the wild-type Tcf4 cDNA, which was used to investigate the role of Tcf4 in MAP4K1 expression and AP-1 dependent transcription.
Snippet: The first 92 bp was deleted using QuickChange II XL Site-Directed Mutagenesis kit (Agilent Technologies) and sub-cloned into pcDNA4/HisMax vector (Life Technologies). The wild-type Tcf4 cDNA was purchased from Origene (Rockville, MD).
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products