OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cdk5rap3 (NM_030248) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508085
Purified recombinant protein of Mouse CDK5 regulatory subunit associated protein 3 (Cdk5rap3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Cdk5rap3 or NM_030248"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208085 protein sequence
Red=Cloning site Green=Tags(s)

MQDHQHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAIQDMPESQEIAQLLSGSYIHYFHCLR
IVDLLKGTEASTKNIFGRYSSQRMKDWQEIVSLYEKDNTYLVELCSLLVRNVSYEIPSLKKQIAKCQQLQ
QEYSRKEEEGQAGAAEMREQFYHSCKQYGITGDNVRRELLALVKDLPSQLAEIGAGAQSLGEAIDLYQAC
VEFVCDSPTEQVLPMLRYVQKKGNSTVYEWRTGTEPSVVERPQLEEPPEQVQEDEIDWGDFGVEAVSDSG
IVAETPGIDWGISLESEAKDAGADKIDWGDDAAAASEITVLETGTEAPEGVARGSDALTLLEYPETRNQF
IDELMELEIFLSQRAVEMSEEADILSVSQFQLAPAILQGQTKEKMLSLVSTLQQLIGRLTSLRMQHLFMI
LASPRYVDRVTEFLQQKLKQSQLLALKKELMVEKQQEALQEQAALEPKLDLLLEKTRELQKLIEADISKR
YSGRPVNLMGTSL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 57 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_084524
Locus ID 80280
UniProt ID Q99LM2
Cytogenetics 11 D
RefSeq Size 1892
RefSeq ORF 1509
Synonyms 1810007E24Rik; BC002318; C53; C81486; HSF-27; IC53; LZAP; MST016
Summary Probable tumor suppressor initially identified as a CDK5R1 interactor controlling cell proliferation. Negatively regulates NF-kappa-B-mediated gene transcription through the control of RELA phosphorylation. Also regulates mitotic G2/M transition checkpoint and mitotic G2 DNA damage checkpoint. Through its interaction with CDKN2A/ARF and MDM2 may induce MDM2-dependent p53/TP53 ubiquitination, stabilization and activation in the nucleus, thereby promoting G1 cell cycle arrest and inhibition of cell proliferation. May play a role in the unfolded protein response, mediating the ufmylation of multiple proteins in response to endoplasmic reticulum stress. May also play a role in the rupture of the nuclear envelope during apoptosis. May regulate MAPK14 activity by regulating its dephosphorylation by PPM1D/WIP1.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products