OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cyp2s1 (NM_028775) Mouse Recombinant Protein

Be the first to review this product
SKU
TP508034
Purified recombinant protein of Mouse cytochrome P450, family 2, subfamily s, polypeptide 1 (Cyp2s1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Cyp2s1 or NM_028775"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR208034 protein sequence
Red=Cloning site Green=Tags(s)

MEAASTWALLLALLLLLLLLSLTLFRTPARGYLPPGPTPLPLLGNLLQLRPGALYSGLLRLSKKYGPVFT
VYLGPWRRVVVLVGHDAVREALGGQAEEFSGRGTLATLDKTFDGHGVFFANGERWKQLRKFTLLALRDLG
MGKREGEELIQAEVQSLVEAFQKTEGRPFNPSMLLAQATSNVVCSLVFGIRLPYDDKEFQAVIQAASGTL
LGISSPWGQAYEMFSWLLQPLPGPHTQLQHHLGTLAAFTIQQVQKHQGRFQTSGPARDVVDAFLLKMAQE
KQDPGTEFTEKNLLMTVTYLLFAGTMTIGATIRYALLLLLRYPQVQQRVREELIQELGPGRAPSLSDRVR
LPYTDAVLHEAQRLLALVPMGMPHTITRTTCFRGYTLPKGTEVFPLIGSILHDPAVFQNPGEFHPGRFLD
EDGRLRKHEAFLPYSLGKRVCLGEGLARAELWLFFTSILQAFSLETPCPPGDLSLKPAISGLFNIPPDFQ
LRVWPTGDQSR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 55.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_083051
Locus ID 74134
UniProt ID Q9DBX6
Cytogenetics 7 A3
RefSeq Size 2621
RefSeq ORF 1503
Synonyms 1200011C15Rik; AU041727; C79779
Summary A cytochrome P450 monooxygenase involved in the metabolism of retinoids and eicosanoids. In epidermis, may contribute to the oxidative metabolism of all-trans-retinoic acid. For this activity, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Additionally, displays peroxidase and isomerase activities toward various oxygenated eicosanoids such as prostaglandin H2 (PGH2) and hydroperoxyeicosatetraenoates (HPETEs). Independently of cytochrome P450 reductase, NADPH, and O2, catalyzes the breakdown of PGH2 to hydroxyheptadecatrienoic acid (HHT) and malondialdehyde (MDA), which is known to act as a mediator of DNA damage.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products