Thnsl2 (NM_178413) Mouse Recombinant Protein

CAT#: TP507732

Purified recombinant protein of Mouse threonine synthase-like 2 (bacterial) (Thnsl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207732 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWYTSTRGMAPRVNFEGALFSGYAPDGGLYMPEELPRLDEETLRHWSTLSYRSLVKELCALFIGLELIPR
  HDLNDLIDRAFSRFRHRNVVHLCKLKNGLNILELWHGVTYAFKDLSLSCTAQFLQYFLEKKKKHVTIVVG
  TSGDTGSAAIESVQGSKNVDIIVLLPKGHCSKIQELQMTTVLKENVHVFEVEGNSDELDEPIKAVFADVA
  FVQRHNVMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPTVEVVVPTGAGGNLAAGCIAQKMGLPIC
  LVVAVNRNDIIHRTVQKGDFSLCEVLRTTLASAMDIQVPYNMERIFWLLSGSDSQTTRALMEQFERTQSL
  QLPKDLHNKLSEAVTSESVTDEAITQTMARCWEENQYLLCPHSATAVNYHYQQTDSGPSSIRCCLASASA
  VKFPKAVQAAGLTPETPAEILALEHKETRCIPMRRGDDWTQMLRVTIEGLSQRWKDCVVNPSE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 54.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848500
• Locus ID: 232078
• UniProt ID: Q80W22
• Cytogenetics: 6 C1
• Refseq Size: 2086
• Refseq ORF: 1452
• Synonyms: BC051244; TSH2
• Summary: Acts as a catabolic phospho-lyase on both gamma- and beta-phosphorylated substrates. Degrades O-phospho-threonine (PThr) to alpha-ketobutyrate, ammonia and phosphate. Also degrades O-phospho-homoserine (PHS), but this is not its physiological substrate.[UniProtKB/Swiss-Prot Function]