OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nelfb (NM_021393) Mouse Recombinant Protein

Be the first to review this product
SKU
TP507622
Purified recombinant protein of Mouse negative elongation factor complex member B (Nelfb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Nelfb or NM_021393"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR207622 protein sequence
Red=Cloning site Green=Tags(s)

MPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESA
LFSTELSVLHNFFSPSPKTRRQGEVVQKLTQMVGKNVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSL
HDLDVSDICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLS
LSTIRHLQELVSQETLPRDSPDLLLLLRLLALGQGAWDLIDSQVFKEPKMEAELITKFLPMLMSLVVDDF
TFNVDQKLPAEEKASVTYPNTLPESFTKFLQEQRMACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDL
AFSDIFLHLLTGSLVLLADEFALEDFCSSLFDGFFLTASPRKENVHRHVLRLLLHLHARVAPSKLEALQK
ALEPTGQSGEAVKELYSQLGEKLEQLDHRKPSPTQAAETPALDLPLPSVPAPATL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_067368
Locus ID 58202
UniProt ID Q8C4Y3
Cytogenetics 2 A3
RefSeq Size 2653
RefSeq ORF 1425
Synonyms A730008L03Rik; AB041607; AI663983; Cob; Cobra1; Nelf-b
Summary This gene encodes subunit B of a metazoan-specific, four-subunit protein complex that regulates promoter-proximal pausing of RNA polymerase II. RNA polymerase II pausing is thought to be important for coordination of gene transcription during embryonic development and stress responses. Consistently, disruption of this gene in mouse causes inner cell mass deficiency and embryonic lethality. In addition, this gene is required for maintenance of mouse embryonic stem cells by preventing expression of developmental genes. In adult mice, conditional deletion of this gene results in cardiomyopathy and impaired response to cardiac stress. Multiple protein isoforms are encoded through the use of a non-AUG (CUG) initiation codon and an alternative downstream AUG initiation codon. In addition, alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2015
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products