OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Pi4k2b (NM_025951) Mouse Recombinant Protein

Be the first to review this product
SKU
TP507499
Purified recombinant protein of Mouse phosphatidylinositol 4-kinase type 2 beta (Pi4k2b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Pi4k2b or NM_025951"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR207499 representing NM_025951
Red=Cloning site Green=Tags(s)

MAEACEPTRPSEDEDEEREPLLPRVAWAQPRRVAPGSAVRMQADEGADVLREPATDEPPAVSGEGSISAS
LSTELDRTRTTSSETNTFLEDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKSE
EPYGQLNPKWTKYVHKVCCPCCFGRGCLLPNQGYLSEAGAYLVDVKLNLGIVPKTKVVWLVSETFNYSAI
DRAKSRGKKYALEKVPKVGRKFHRIGLPPKVGSFQLFVKDYKEAEYWLRRFEAEPLPENIRKQFQSQFEK
LVILDYIIRNTDRGNDNWLVKYDEMKYAKKIESEESNWIDNKQLLIKIAAIDNGLAFPFKHPDEWRAYPF
HWAWLPQAKVPFSEETRNLILPYISDMNFVQDLCEDLYELFKTDKGFDRAAFENQMSVMRGQILNLTQAL
RDGKSPMQLAQMPCVIVECSKSGSQGRVVHLGSSFTQTVHCRKPFFSSW

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080227
Locus ID 67073
UniProt ID Q8CBQ5
Cytogenetics 5 C1
RefSeq Size 3143
RefSeq ORF 1407
Synonyms 2610042N09Rik; 4933409G22Rik
Summary Together with PI4K2A and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. This contribution may be especially significant in plasma membrane, endosomal and Golgi compartments. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells and is likely to be involved in the regulation of vesicular trafficking (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products