OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Riox2 (NM_025910) Mouse Recombinant Protein

Be the first to review this product
SKU
TP507428
Purified recombinant protein of Mouse ribosomal oxygenase 2 (Riox2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA362916 RIOX2 Antibody - middle region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Riox2 or NM_025910"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR207428 protein sequence
Red=Cloning site Green=Tags(s)

MPKKVQPTGDENEEESVPCKRVKEELPETLSVLNFDSPSSFFESLISPIKVETFFKEFWEQKPLLIQRDD
PVLAKYYQSLFSLSDLKRLCKKGVYYGRDVNVCRSISGKKKVLNKDGRAHFLQLRKDFDQKRATIQFHQP
QRYKDELWRIQEKLECYFGSLVGSNVYMTPAGSQGLPPHYDDVEVFILQLEGTKHWRLYSPTVPLAHEYS
VESEDRIGTPTHDFLLKPGDLLYFPRGTIHQAETPSGLAYSIHLTISTYQNNSWGDCLLDSISGFVFDIA
KEDVALRSGMPRRMLLNVETPADVTRKLSGFLRTLADQLEGREELLSSDMKKDFVKHRLPPFFEGNGTET
MDPGKQLPRLDNIIRLQFKDHIVLTVGPDKNPFDEAQQKVVYIYHSLKNVRQMHMIGEEEESEIFGLRFP
LSHVDALKQIWCGSPIRVKELKLDTDEEKENLALSLWSESLIQVL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080186
Locus ID 67014
UniProt ID Q8CD15
Cytogenetics 16 C1.3
RefSeq Size 2159
RefSeq ORF 1395
Synonyms 1810047J07Rik; 2410057H13Rik; 3830408E23Rik; AI449204
Summary Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Is involved in the demethylation of trimethylated 'Lys-9' on histone H3 (H3K9me3), leading to an increase in ribosomal RNA expression. Also catalyzes the hydroxylation of 60S ribosomal protein L27a on 'His-39' (By similarity). May play an important role in cell growth and survival. May be involved in ribosome biogenesis, most likely during the assembly process of pre-ribosomal particles.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products