Sil1 (NM_030749) Mouse Recombinant Protein

CAT#: TP507424

Purified recombinant protein of Mouse endoplasmic reticulum chaperone SIL1 homolog (S. cerevisiae) (Sil1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207424 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPQHLPSTRMASPGMLLGLLLTSCLTLCLSCQNSNNFALTNPEKSIHQESDTKETREEEELDTEILEVF
  HPTQEWQTLQPGQAVPAGSHVRMNLQTGVNEVKLQQEDKFQNNLKGFKRGRRLDINANTYTSQDLKSALA
  KFKEGTEMENSKDELARQATVKQLFRPIEELKKEFDELNVVLETDMQIMVRLINKFNSSSSSLEEKVAAL
  FDLEYYVHQMDNAQDLLSFGGLQVVINGLNSTEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVI
  LATNQPLPAKKKVLFALCSLLRHFPYAQQQFLKLGGLQVLRSLVQEKSAKVLAVRVVTLLYDLVTEKMFA
  EEEAELTQDSSPEKLQQYRQVQLLPGLQEQGWCEITAQLLALPEHDAREKVLQTLGALLTTCRDRYRQDL
  QLSRTLGRLQAEYQALASLELQEGEDDGYFRELLASINSLMKELR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 52.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_109674
• Locus ID: 81500
• UniProt ID: Q9EPK6
• Cytogenetics: 18 B1-B2
• Refseq Size: 1715
• Refseq ORF: 1398
• Synonyms: 1810057E01Rik; AI042831; wz
• Summary: Required for protein translocation and folding in the endoplasmic reticulum (ER). Functions as a nucleotide exchange factor for the ER lumenal chaperone HSPA5 (By similarity).[UniProtKB/Swiss-Prot Function]