C80913 (BC023029) Mouse Recombinant Protein

CAT#: TP507303

Purified recombinant protein of Mouse expressed sequence C80913 (cDNA clone MGC:36045 IMAGE:5374731), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207303 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVPFGPLAFMPGKLVHTNEVTVLLGDNWFAKCSAKQAVGLVEHRKEHVRKTIDDFKKVLKNFESRVEFTE
  DLQKMSDAAGDFVDIREEIKSDFEFKGKQRIAHKPHSKPKTSDIFEADFENGVKPKDTFDADELWARLEE
  LERQEELLGELESKPDTVIANGEDRVSSEEEKEGADTGVNVVSPVTDSSAASSCKRRAGNAGLPNGQVNS
  LNYSVNGSNSYHSNKDDDEEEDDDDDDDDEDDDNESDHAISADNSIPTIYFSHTVEPKRVRINTGKNTTL
  KFSEKKEEAKRKRKSGAGSHATHELPAIKSPADIYRVFVDVVNGEYVPHKSILKSRSRENSVCSDTSESS
  AADVEDRRGLLRSTSSEEAVATEAGGSSLDELQENHPKKPLPSGVSEAFSGTVIEKEFLSPSLAPYSAIA
  HHALPTIPERKEVPSEVSEEPTKRVSKFRAARLQQRS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 50.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 19777
• UniProt ID: Q3TLD5
• Cytogenetics: 7 B3
• Refseq Size: 2462
• Refseq ORF: 1371
• Synonyms: Rmp, NNX3
• Summary: Involved in gene transcription regulation. Acts as a transcriptional repressor in concert with the corepressor UXT to regulate androgen receptor (AR) transcription. May act as a tumor suppressor to repress AR-mediated gene transcription and to inhibit anchorage-independent growth in prostate cancer cells. Required for cell survival in ovarian cancer cells. Together with UXT, associates with chromatin to the NKX3-1 promoter region (By similarity).[UniProtKB/Swiss-Prot Function]