Ppm1f (NM_176833) Mouse Recombinant Protein

CAT#: TP507220

Purified recombinant protein of Mouse protein phosphatase 1F (PP2C domain containing) (Ppm1f), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207220 representing NM_176833
  Red=Cloning site Green=Tags(s)
  
  MASGAAQNSSQMACDSEIPGFLDAFLQDFPAPLSLESPLPWKVPGTVLSQEEVEAELIELALGFLGSRNA
  PPSFAVAVTHEAISQLLQTDLSEFKRLPEQEEEEEEEEEEKALVTLLDAKGLARSFFNCLWKVCSQWQKQ
  VPLTAQAPQWQWLVSIHAIRNTRRKMEDRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASVHV
  HTNASHQPELRTNPAAALKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDSQVILVQQG
  RVVKLMEPHKPERQDEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRELTGSED
  YLLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMRIAEELVAVARDRGSHDNITVMVVFLREPLELLEGG
  VQGTGDAQADVGSQDLSTGLSELEISNTSQRS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 50.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_789803
• Locus ID: 68606
• UniProt ID: Q8CGA0
• Cytogenetics: 16 A3
• Refseq Size: 4933
• Refseq ORF: 1356
• Synonyms: 1110021B16Rik; 4933427B07Rik; CaMKPase; mKIAA0015; Popx2
• Summary: Dephosphorylates and concomitantly deactivates CaM-kinase II activated upon autophosphorylation, and CaM-kinases IV and I activated upon phosphorylation by CaM-kinase kinase. Promotes apoptosis (By similarity).[UniProtKB/Swiss-Prot Function]