OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

E2f1 (NM_007891) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506856
Purified recombinant protein of Mouse E2F transcription factor 1 (E2f1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "E2f1 or NM_007891"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206856 representing NM_007891
Red=Cloning site Green=Tags(s)

MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQLPAAPPTGPRDSDVLLFATPQAPRPA
PSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSR
SADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTMVGIGKRLEGLTQDLQQLQE
SEQQLDHLMHICTTQLQLLSEDSDTQRLAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSSETFQIS
LKSKQGPIDVFLCPEESADGISPGKTSCQETSSGEDRTADSGPAGPPPSPPSTSPALDPSQSLLGLEQEA
VLPRMGHLRVPMEEDQLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPHEALDYHFGLEEGEGIRDLFDC
DFGDLTPLDF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_031917
Locus ID 13555
UniProt ID Q61501
Cytogenetics 2 76.79 cM
RefSeq Size 2469
RefSeq ORF 1290
Synonyms E2F-1; mKIAA4009; Tg(Wnt1-cre)2Sor
Summary Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTCCGCGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from G1 to S phase. E2F1 binds preferentially RB1 in a cell-cycle dependent manner. It can mediate both cell proliferation and TP53/p53-dependent apoptosis. Blocks adipocyte differentiation by binding to specific promoters repressing CEBPA binding to its target gene promoters (PubMed:11672531, PubMed:20176812). Positively regulates transcription of RRP1B (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Growth Factors, Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Recruitment of Pontin/Reptin by E2f1 amplifies E2f transcriptional response during cancer progression
Tarangelo, Lo, Teng et al
Nat Commun (2015) 6, 10028 DOI: 10.1038/ncomms10028
Cited by 67
AI Summary: In this paper, OriGene products—specifically the pCMV6-E2f1 expression plasmid and E2f1 shRNA lentiviral particles—were used to modulate E2f1 levels in cells, enabling the authors to investigate how E2f1 recruitment of the Pontin/Reptin complex amplifies E2f transcriptional responses during cancer progression.
Snippet: Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products