Smyd3 (NM_027188) Mouse Recombinant Protein

CAT#: TP506824

Purified recombinant protein of Mouse SET and MYND domain containing 3 (Smyd3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206824 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEALKVEKFTTANRGNGLRAVAPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGKEKLMRCSQCRIAKY
  CSAKCQKKAWPDHRRECSCLKSCKPRYPPDSVRLLGRVIVKLMDEKPSESEKLYSFYDLESNISKLTEDK
  KEGLRQLAMTFQHFMREEIQDASQLPPSFDLFEAFAKVICNSFTICNAEMQEVGVGLYPSMSLLNHSCDP
  NCSIVFNGPHLLLRAVREIEAGEELTICYLDMLMTSEERRKQLRDQYCFECDCIRCQTQDKDADMLTGDE
  QIWKEVQESLKKIEELKAHWKWEQVLALCQAIINSNSNRLPDINIYQLKVLDCAMDACINLGMLEEALFY
  AMRTMEPYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMKVTHGREHSLIEDLILLLEE
  CDANIRAS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 49.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081464
• Locus ID: 69726
• UniProt ID: Q9CWR2
• Cytogenetics: 1 83.48 cM
• Refseq Size: 3769
• Refseq ORF: 1287
• Synonyms: 2410008A19Rik; Zmynd1
• Summary: Histone methyltransferase. Specifically methylates 'Lys-4' of histone H3, inducing di- and tri-methylation, but not monomethylation. Also methylates 'Lys-5' of histone H4. Plays an important role in transcriptional activation as a member of an RNA polymerase complex. Binds DNA containing 5'-CCCTCC-3' or 5'-GAGGGG-3' sequences.[UniProtKB/Swiss-Prot Function]