OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Entpd5 (NM_001026214) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506800
Purified recombinant protein of Mouse ectonucleoside triphosphate diphosphohydrolase 5 (Entpd5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Entpd5 or NM_001026214"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206800 protein sequence
Red=Cloning site Green=Tags(s)

MATSWGAVFMLIIACVGSTVFYREQQTWFEGVFLSSMCPINVSAGTFYGIMFDAGSTGTRIHVYTFVQKT
AGQLPFLEGEIFDSVKPGLSAFVDQPKQGAETVQELLEVAKDSIPRSHWERTPVVLKATAGLRLLPEQKA
QALLLEVEEIFKNSPFLVPDGSVSIMDGSYEGILAWVTVNFLTGQLHGRGQETVGTLDLGGASTQITFLP
QFEKTLEQTPRGYLTSFEMFNSTFKLYTHSYLGFGLKAARLATLGALEAKGTDGHTFRSACLPRWLEAEW
IFGGVKYQYGGNQEGEMGFEPCYAEVLRVVQGKLHQPEEVRGSAFYAFSYYYDRAADTHLIDYEKGGVLK
VEDFERKAREVCDNLGSFSSGSPFLCMDLTYITALLKDGFGFADGTLLQLTKKVNNIETGWALGATFHLL
QSLGITS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001021385
Locus ID 12499
UniProt ID Q9WUZ9
Cytogenetics 12 39.18 cM
RefSeq Size 4987
RefSeq ORF 1281
Synonyms AI196558; AI987697; Cd39l4; ER-UDPase; mNTPase; NTPDase-5; NTPDase5; Pcph
Summary Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. The nucleotide hydrolyzing preference is GDP > IDP > UDP, but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products