Mfge8 (NM_001045489) Mouse Recombinant Protein

CAT#: TP506789

Purified recombinant protein of Mouse milk fat globule-EGF factor 8 protein (Mfge8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Mfge8 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206789 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQVSRVLAALCGMLLCASGLFAASGDFCDSSLCLNGGTCLTGQDNDIYCLCPEGFTGLVCNETERGPCSP
  NPCYNDAKCLVTLDTQRGDIFTEYICQCPVGYSGIHCETGCSTQLGMEGGAIADSQISASSVYMGFMGLQ
  RWGPELARLYRTGIVNAWTASNYDSKPWIQVNLLRKMRVSGVMTQGASRAGRAEYLKTFKVAYSLDGRKF
  EFIQDESGGDKEFLGNLDNNSLKVNMFNPTLEAQYIRLYPVSCHRGCTLRFELLGCELHGCSEPLGLKNN
  TIPDSQMSASSSYKTWNLRAFGWYPHLGRLDNQGKINAWTAQSNSAKEWLQVDLGTQRQVTGIITQGARD
  FGHIQYVASYKVAHSDDGVQWTVYEEQGSSKVFQGNLDNNSHKKNIFEKPFMARYVRVLPVSWHNRITLR
  LELLGC
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001038954
• Locus ID: 17304
• UniProt ID: Q3TDU5
• Cytogenetics: 7 44.9 cM
• Refseq Size: 2032
• Refseq ORF: 1281
• Synonyms: AA408458; AI325141; lactadherin; MFG-E8; Mfgm; MP47; P47; SED1
• Summary: Contributes to phagocytic removal of apoptotic cells in many tissues. Specific ligand for the alpha-v/beta-3 and alpha-v/beta-5 receptors. Also binds to phosphatidylserine-enriched cell surfaces in a receptor-independent manner. Zona pellucida-binding protein which may play a role in gamete interaction (By similarity). Plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization.[UniProtKB/Swiss-Prot Function]