OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Lnpk (NM_027133) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506767
Purified recombinant protein of Mouse lunapark, ER junction formation factor (Lnpk), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Lnpk or NM_027133"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206767 protein sequence
Red=Cloning site Green=Tags(s)

MGGLFSRWRAKPSTVEVLENIDKEIQALEEFREKNQRLQKLWVGRLIIYSSILYLFTCLIVYLWYLPDEF
TARLVMTLPFFAFPLIIWTLRTVLIFFFSKRTERNNEALDDLKSQKKKILEEVMEKETYKTAKLILERFD
PDSKKAKEFEPPSAGAAVTAKPGQEIRQRTAAQRNLSPAPASSSQGPPPQGPVSPGPAKDASAPGGPPER
TVAPALPRRLGSPATSVPGMGLHPPGPPLARPILPRERGALDRIVEYLVGDGPQNRYALICQQCFSHNGM
ALKEEFEYIAFRCAYCFFLNPARKTRPQAPRLPEFSFEKRQAVEGSSSTGPTLLESVPSAESQLIEDSLE
EQDVLDNSTEQRDDKIPVTEQTSQVIEKTSGPEEPAENQEETENEETSTNEAKSPVLRADSVPNLEPSEE
SLVTK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_081409
Locus ID 69605
UniProt ID Q7TQ95
Cytogenetics 2 C3
RefSeq Size 8692
RefSeq ORF 1275
Synonyms 2310011O18Rik; 4921514L11Rik; 9530051D01Rik; AI666268; Lnp; Lnpk1; Ul; ulnaless
Summary Endoplasmic reticulum (ER)-shaping membrane protein that plays a role in determining ER morphology. Involved in the stabilization of nascent three-way ER tubular junctions within the ER network. May also play a role as a curvature-stabilizing protein within three-way ER tubular junction network. May be involved in limb and central nervous system development (PubMed:12732147).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products