OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Stambp (NM_024239) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506746
Purified recombinant protein of Mouse STAM binding protein (Stambp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Stambp or NM_024239"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206746 protein sequence
Red=Cloning site Green=Tags(s)

MSDHGDVSLPPQDRVRILSQLGSAVELNEDIPPRRYYRSGVEIIRMASVYSEEGNIEHAFILYNKYITLF
IEKLPKHRDYKSAIIPEKKDAVKKLKSVAFPKAEELKTELLRRYTKEYEQYKERKKKEEEELARNIAIQQ
ELEKEKQRVAQQKQKQLEQEQFHAFEEMIQRQELEKERLKIVQEFGKVDPGPCGPLLPDLEKPCVDVAPS
SPFSPTQTPDCNTGMRPAKPPVVDRSLKPGALSVIENVPTIEGLRHIVVPRNLCSEFLQLASANTAKGIE
TCGVLCGKLMRNEFTITHVLIPRQNGGPDYCHTENEEEIFFMQDDLGLLTLGWIHTHPTQTAFLSSVDLH
THCSYQMMLPESIAIVCSPKFQETGFFKLTDYGLQEISTCRQKGFHPHGRDPPLFCDCSHVTVKDRIVTI
TDLR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_077201
Locus ID 70527
UniProt ID Q9CQ26
Cytogenetics 6 C3
RefSeq Size 2157
RefSeq ORF 1272
Synonyms 5330424L14Rik; 5730422L11Rik; Amsh; AW107289; mKIAA4198
Summary Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains (By similarity). Plays a role in signal transduction for cell growth and MYC induction mediated by IL-2 and GM-CSF. Potentiates BMP (bone morphogenetic protein) signaling by antagonizing the inhibitory action of SMAD6 and SMAD7 (By similarity). Involved in the ubiquitin-dependent sorting and trafficking of receptors from endosomes to lysosome. Endosomal localization of STAMBP is required for efficient EGFR degradation but not for its internalization. Involved in the negative regulation of PI3K-AKT-mTOR and RAS-MAP signaling pathways (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Enzyme: Peptidases, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products