OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Acp2 (NM_007387) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506733
Purified recombinant protein of Mouse acid phosphatase 2, lysosomal (Acp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Acp2 or NM_007387"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206733 protein sequence
Red=Cloning site Green=Tags(s)

MAGRQTGWSQAALLQFLLGMCLTVMPPIQARSLRFVTLLYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTK
EGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIP
VHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTL
FCEQTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFPKL
LVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQEDNGNFSVEMYFRNDSKKAPWPLILPGCPHRCP
LQDFLRLTEPVIPKDWQKECQLANDTADTEVIVALAVCGSILFLLIVLLLTILFRMQAQPPGYHHVADRE
DHA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_031413
Locus ID 11432
UniProt ID P24638
Cytogenetics 2 50.54 cM
RefSeq Size 4669
RefSeq ORF 1269
Synonyms Acp; Acp-2; LAP
Summary The protein encoded by this gene belongs to the histidine acid phosphatase family, which hydrolyze orthophosphoric monoesters to alcohol and phosphate. This protein is localized to the lysosomal membrane, and is chemically and genetically distinct from the red cell acid phosphatase. Mice lacking this gene showed multiple defects, including bone structure alterations, lysosomal storage defects, and an increased tendency towards seizures. An enzymatically-inactive allele of this gene showed severe growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype. Two isoforms are predicted to be produced from the same mRNA by the use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. provided by RefSeq, Oct 2017
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products