OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rad23b (NM_009011) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506575
Purified recombinant protein of Mouse RAD23 homolog B, nucleotide excision repair protein (Rad23b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rad23b or NM_009011"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206575 protein sequence
Red=Cloning site Green=Tags(s)

MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILSDDTALKEYKIDEKNFV
VVMVTKPKAVTTAVPATTQPSSTPSPTTVSSSPAVAAAQAPAPTPALAPTSTPASTTPASTTASSEPAPA
GATQPEKPAEKPAQTPVLTSPAPADSTPGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAA
LRASFNNPDRAVEYLLMGIPGDRESQAVVDPPPQAVSTGTPQSPAVAAAAATTTATTTTTSGGHPLEFLR
NQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGGGGGG
GGGGGIAEAGSGHMNYIQVTPQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 43.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_033037
Locus ID 19359
UniProt ID P54728
Cytogenetics 4 B3
RefSeq Size 3827
RefSeq ORF 1248
Synonyms 0610007D13Rik; AV001138; HR23B; mHR23B; p58
Summary Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome. May play a role in endoplasmic reticulum-associated degradation (ERAD) of misfolded glycoproteins by association with PNGase and delivering deglycosylated proteins to the proteasome.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products