Stap2 (NM_145934) Mouse Recombinant Protein

CAT#: TP506459

Purified recombinant protein of Mouse signal transducing adaptor family member 2 (Stap2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206459 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATALSPPRGPKLKGAPPSHYYESFLEKKGPCDQDYRKFWAGLQGLAICFYNSNRDLQPLEKLDLRLFSK
  LRDEALLGSSRDTAYHFSLVLRDQEVKFKVESLESCEMWKGFILTVVELRVPSNLTLLPGHLYMMAEVLT
  KEEVRRAAEVPWCFLQVSRLEAQLLLERYPECGNLLLRPGGDGKDSVSVTTRQILNGSPVVKHYKVKRAG
  SKYVIDVEDPFSCPSLEAVVNYFVTHTKRALVPFLLDEDYEKVLGFVDSDRENGESAWAVPSFRASGPAL
  PANVLKPLPPVPVSVSSQEDKLPQLPPLPQLPDTDENYVTPIEDSPAAEYMNQDVSLSSQAVPLKPKKPA
  RLPAKPPKPSVVPKPDLKAITSVWTRKLGGSSSQASSLVTRLGDITAELEEKLQKRRALEH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 45.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666046
• Locus ID: 106766
• UniProt ID: Q8R0L1
• Cytogenetics: 17 D
• Refseq Size: 1532
• Refseq ORF: 1236
• Synonyms: AW049765; STAP-2
• Summary: Substrate of protein kinase PTK6 (By similarity). May play a regulatory role in the acute-phase response in systemic inflammation and may modulate STAT3 activity.[UniProtKB/Swiss-Prot Function]