OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Acy1 (NM_025371) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506415
Purified recombinant protein of Mouse aminoacylase 1 (Acy1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Acy1 or NM_025371"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206415 protein sequence
Red=Cloning site Green=Tags(s)

MTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNP
SLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIH
MTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRF
IEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPD
VDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSR
YIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079647
Locus ID 109652
UniProt ID Q99JW2
Cytogenetics 9 57.49 cM
RefSeq Size 1459
RefSeq ORF 1224
Synonyms 1110014J22Rik; Acy-1
Summary Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).UniProtKB/Swiss-Prot Function
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Proteomic profiling reveals biomarkers and pathways in type 2 diabetes risk
Ngo, Benson, Long et al
JCI Insight (2021) 6 (5) DOI: 10.1172/jci.insight.144392
Cited by 85
AI Summary: OriGene’s pCMV6-ENTRY plasmid containing the full-length mouse ACY1 gene (NM_025371) was used to generate AAV vectors for functional studies investigating the role of ACY1 in type 2 diabetes risk.
Snippet: AAV production. pCMV6-ENTRY plasmid containing a full-length mouse ACY-1-myc-ddk insert was purchased (NM_025371, OriGene Technologies) and subcloned into pENN.AAV8.CB7.CI.WPRE.rBG (Penn Vector Core, Philadelphia, Pennsylvania, USA) using the EcoRV/XhoI sites
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products