OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ddx17 (NM_199079) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506397
Purified recombinant protein of Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 (Ddx17), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Ddx17 or NM_199079"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206397 protein sequence
Red=Cloning site Green=Tags(s)

MRGGGFGDRDRDRDRGGFGARGGSGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEV
DELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGS
GKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIR
DLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATW
PKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMVSEKDHKLIQLMEEIMAEKENKTIIFVETKR
RCDDLTRRMRRYGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLGLYR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_951061
Locus ID 67040
UniProt ID Q501J6
Cytogenetics 15 E1
RefSeq Size 2860
RefSeq ORF 1221
Synonyms 2610007K22Rik; A430025E01Rik; AI047725; C80929; Gm926; p7; p72
Summary This gene encodes the mouse homolog of human DEAD box polypeptide 17. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). RNA helicases of the DEAD-box family are involved in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Alternative splicing of this gene results in several transcript variants encoding different isoforms. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

A network comprising short and long noncoding RNAs and RNA helicase controls mouse retina architecture
Krol, Krol, Alvarez et al
Nat Commun (2015) 6, 7305 DOI: 10.1038/ncomms8305
Cited by 86
AI Summary: OriGene's pCMV-MIR vector was used to clone and express the pri-miR-183/96/182 construct, enabling the study of its role in regulating mouse retina architecture.
Snippet: The corresponding DNA was chemically synthesized by GENEWIZ (South Plainfield) and cloned into the XhoI-cleaved beta-globin intron of the pEGP backbone (to yield pEGP-T2-pri-miR-183/96/182) or into pCMV-MIR vector (OriGene Technologies) directly downstream of the CMV promoter (to yield pCMV-T2-pri-miR-183/96/182)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products