OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Olfml3 (NM_133859) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506381
Purified recombinant protein of Mouse olfactomedin-like 3 (Olfml3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Olfml3 or NM_133859"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206381 protein sequence
Red=Cloning site Green=Tags(s)

MGPSAPLLLLFFLSWTGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAE
KERETLRTEADSISGRVDRLEREVDYLETQNPALPCVELDEKVTGGPGAKGKGRRNEKYDMVTDCSYTVA
QVRSMKILKRFGGSAGLWTKDPLGPAEKIYVLDGTQNDTAFVFPRLRDFTLAMAARKASRIRVPFPWVGT
GQLVYGGFLYYARRPPGGPGGGGELENTLQLIKFHLANRTVVDSSVFPAESLIPPYGLTADTYIDLAADE
EGLWAVYATRDDDRHLCLAKLDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFD
ASGTLAPERAALSYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMKKKEEEV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_598620
Locus ID 99543
UniProt ID Q8BK62
Cytogenetics 3 F2.2
RefSeq Size 1736
RefSeq ORF 1218
Synonyms 2810002E22Rik; AI115209; AW550633; HNOEL-iso; mONT3; ONT3
Summary Secreted scaffold protein that plays an essential role in dorsoventral patterning during early development. Stabilizes axial formation by restricting chordin (CHRD) activity on the dorsal side. Acts by facilitating the association between the tolloid proteases and their substrate chordin (CHRD), leading to enhance chordin (CHRD) degradation (By similarity). May have matrix-related function involved in placental and embryonic development, or play a similar role in other physiological processes (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products