Sag (NM_009118) Mouse Recombinant Protein

CAT#: TP506320

Purified recombinant protein of Mouse S-antigen, retina and pineal gland (arrestin) (Sag), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206320 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAACGKTNKSHVIFKKVSRDKSVTIYLGKRDYVDHVSQVEPVDGVVLVDPELVKGKKVYVTLTCAFRYGQ
  EDIDVMGLTFRRDLYFSRVQVYPPVGAMSVLTQLQESLLKKLGDNTYPFLLTFPDYLPCSVMLQPAPQDV
  GKSCGVDFEVKAFASDITDPEEDKIPKKSSVRLLIRKVQHAPPEMGPQPSAEASWQFFMSDKPLNLSVSL
  SKEIYFHGEPIPVTVTVTNNTDKVVKKIKVSVEQIANVVLYSSDYYVKPVASEETQEKVQPNSTLTKTLV
  LVPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVMGILVSYHIKVKLTVSGFLGELTSSEVAT
  EVPFRLMHPQPEDPAKESVQDENLVFEEFARQNLKDTGENPEGKKDEDAGQDE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 44.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033144
• Locus ID: 20215
• UniProt ID: P20443, Q3UPX6
• Cytogenetics: 1 44.44 cM
• Refseq Size: 1718
• Refseq ORF: 1212
• Synonyms: A930001K18Rik; Arr1; arrestin; Irbp
• Summary: Binds to photoactivated, phosphorylated RHO and terminates RHO signaling via G-proteins by competing with G-proteins for the same binding site on RHO (PubMed:9333241, PubMed:16421323). May play a role in preventing light-dependent degeneration of retinal photoreceptor cells (PubMed:16421323).[UniProtKB/Swiss-Prot Function]