Gcnt2 (NM_133219) Mouse Recombinant Protein

CAT#: TP506293

Purified recombinant protein of Mouse glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (Gcnt2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206293 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLRGKVFAVSALSVVIFVVFYHSQLSLPNLYQQLNSSSERTSVTICDYGLQNHTFFTTGDTSPHPLERL
  SCPQYRIQSHYITSPLSEEEAAFPLAYIMVIHKDFDTFERLFRAIYMPQNVYCVHVDSKATDTFKEAVRQ
  LLSCFPNAFLASKVEQVVYGGFSRLQADLNCMKDLVASKVPWKYVLNTCGQDFPLKTNKEIINHLKRFKG
  KNITPGVLPPAYIVVRTKYVHQERKGKDGYFMHKTNILKTPPPHQLIIYFGTAYVALTRDFVNFILNDER
  AIALLEWSKDTYSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGN
  GDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 46 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_573482
• Locus ID: 14538
• UniProt ID: Q7TPQ8
• Cytogenetics: 13 20.12 cM
• Refseq Size: 4021
• Refseq ORF: 1206
• Synonyms: 5330430K10Rik; IGnT; IGnTA; IGnTB; IGnTC
• Summary: Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells.[UniProtKB/Swiss-Prot Function]