Cd3eap (NM_145822) Mouse Recombinant Protein

CAT#: TP506264

Purified recombinant protein of Mouse CD3E antigen, epsilon polypeptide associated protein (Cd3eap), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206264 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGTQACSATRFSCPPHFTEMSPDSEPSRFSLEALTGPDTELWLIQAPADFAPQCLNGRRVPLSGSKTVK
  GKLDGKKHRYRVFTSSPQAREATLLASSSEAGGRLTCAPAPSGSLRIMEGPQEYLLSRVPLQLIPTSLPP
  QIPAGLRPRFSAFGGSPPVTGPGSASALRSPTSGKRKSTRKGTDASSDTQEAVNRHGAMEVKTALGNLGV
  SVKKRKRYFMQEEMEAKTMEPVAELPVPSATSSKKRKKSKGTETSQVEHTEPVAQTEPPEGTFLFPTKKR
  KRQKEADGTEEVDGIVADSQPQVIVEAQEETILLSPTKKRRKEKRQNLGMEAEMGPPGVLMVTEHSEHGL
  QAEVALVSPKKTKKKKGKRVGETEAALPDDFEPQGALAPSKKKERGARL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 43.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_665821
• Locus ID: 70333
• UniProt ID: Q76KJ5
• Cytogenetics: 7 A3
• Refseq Size: 2248
• Refseq ORF: 1200
• Synonyms: 1190028F09; 2610103M17Rik; ASE-1; Ase1; CAST; PAF49
• Summary: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Involved in UBTF-activated transcription, presumably at a step following PIC formation.[UniProtKB/Swiss-Prot Function]