Rragc (NM_017475) Mouse Recombinant Protein

CAT#: TP506250

Purified recombinant protein of Mouse Ras-related GTP binding C (Rragc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206250 representing NM_017475
  Red=Cloning site Green=Tags(s)
  
  MSLQYGAEETPLAGSYGAADSFPKDFGYGVEEEEEEAAAGGGGGAGAGGGCGPGGADSSKPRILLMGLRR
  SGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQMDFFDPTFDYEMIFRGTGALI
  YVIDAQDDYMEALTRLHITVSKAYKVNPDMNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKL
  HLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSSPVDMQS
  YELCCDMIDVVIDVSCIYGLKEDGSGSAYDKESMAIIKLNNTTVLYLKEVTKFLALVCILREESFERKGL
  IDYNFHCFRKAIHEVFEVGVTSHRSCSHQTSAPSLKALAHNGTPRNAI
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 44.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_059503
• Locus ID: 54170
• UniProt ID: Q99K70
• Cytogenetics: 4 D2.2
• Refseq Size: 2621
• Refseq ORF: 1194
• Synonyms: AU041672; Gtr2; RAGC; TIB929; YGR163W
• Summary: Guanine nucleotide-binding protein forming heterodimeric Rag complexes required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids (By similarity).[UniProtKB/Swiss-Prot Function]