P2rx3 (NM_145526) Mouse Recombinant Protein

CAT#: TP506221

Purified recombinant protein of Mouse purinergic receptor P2X, ligand-gated ion channel, 3 (P2rx3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206221 representing NM_145526
  Red=Cloning site Green=Tags(s)
  
  MNCISDFFTYETTKSVVVKSWTIGIINRAVQLLIISYFVGWVFLHEKAYQVRDTAIESSVVTKVKGFGRY
  ANRVMDVSDYVTPPQGTSVFVIITKMIVTENQMQGFCPENEEKYRCVSDSQCGPERFPGGGILTGRCVNY
  SSVRRTCEIQGWCPTEVDTVEMPIMMEAENFTIFIKNSIRFPLFNFEKGNLLPNLTDKDIKKCRFHPEKA
  PFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKYSFTRLDGVSEKSSVSPGYNF
  RFAKYYKMENGSEYPTLLKAFGIRFDVLVYGNAGKFNIIPTIISSVAAFTSVGVGTVLCDIILLNFLKGA
  DHYKARKFEEVTETTLKGTASTNPVFTSDQATVEKQSTDSGAYSIGH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 44.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_663501
• Locus ID: 228139
• UniProt ID: Q3UR32
• Cytogenetics: 2 D
• Refseq Size: 4190
• Refseq ORF: 1191
• Synonyms: 4930513E20Rik; P2X3
• Summary: Receptor for ATP that acts as a ligand-gated cation channel (By similarity). Plays a role in sensory perception (PubMed:15961431, PubMed:16322458). Required for normal perception of pain (PubMed:15961431). Required for normal taste perception (PubMed:16322458).[UniProtKB/Swiss-Prot Function]