Mat1a (NM_133653) Mouse Recombinant Protein

CAT#: TP506213

Purified recombinant protein of Mouse methionine adenosyltransferase I, alpha (Mat1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206213 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNGPVDGLCDHSLSEEGAFMFTSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCG
  EITSVAMVDYQRVVRDTIKHIGYDDSAKGFDFKTCNVLVALEQQSPDIAQCVHLDRNEEDVGAGDQGLMF
  GYATDETEECMPLTIVLAHKLNTRIADLRRSGVLPWLRPDSKTQVTVQYMQDNGAVIPVRIHTIVISVQH
  NEDITLEAMQEALKEQVIKAVVPAKYLDEDTVYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGAHGG
  GAFSGKDYTKVDRSAAYAARWVAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSNKTERELLEVV
  NKNFDLRPGVIVRDLDLKKPIYQKTACYGHFGRSEFPWEVPKKLVF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 43.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598414
• Locus ID: 11720
• UniProt ID: Q91X83
• Cytogenetics: 14 B
• Refseq Size: 3486
• Refseq ORF: 1191
• Synonyms: A; AdoM; AdoMet; AI046368; Ams; MA; MAT; MATA1; S; SA; SAMS; SAMS1
• Summary: This gene encodes a member of the AdoMet synthase family. Methionine adenosyltransferase is a product of this gene (the alpha form) and the beta form and catalyzes the formation of S-adenosylmethionine from methionine and ATP.[provided by RefSeq, Jan 2013]