Asah1 (NM_019734) Mouse Recombinant Protein
CAT#: TP506162
Purified recombinant protein of Mouse N-acylsphingosine amidohydrolase 1 (Asah1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Frequently bought together (1)
Other products for "Asah1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206162 protein sequence
Red=Cloning site Green=Tags(s) MRGQSLLTWVLAAAVTCAQAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAP ALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFT MCTSIITEDEKGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFVGYVGML TGFKPGLFSLSLNERFSINGGYLGILEWMFGRKDAQWVGFITRSVLENTTSYEEAKNTLTKTKIMAPVYF ILGGKKSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFIDDRRTPAKKCLNHTTQKNLSF ATIYDVLSTKPVLNKLTVFTTLMDVTKGQFESHLRDCPDPCIGW myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 44.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062708 |
Locus ID | 11886 |
UniProt ID | Q9WV54, Q78P93 |
Cytogenetics | 8 A4 |
Refseq Size | 2251 |
Refseq ORF | 1185 |
Synonyms | 2310081N20Rik; AC; Asah |
Summary | This gene encodes acid ceramidase, an enzyme that plays a central role in ceramide metabolism. The encoded protein undergoes proteolytic processing to generate a heterodimeric enzyme comprised of alpha and beta subunits that catalyzes the hydrolysis of sphingolipid ceramide into sphingosine and free fatty acid. The homozygous disruption of this gene leads to embryonic lethality in mice whereas the heterozygous animals exhibit a progressive lipid storage disease phenotype. [provided by RefSeq, Oct 2015] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.