OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rad9a (NM_011237) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506078
Purified recombinant protein of Mouse RAD9 checkpoint clamp component A (Rad9a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rad9a or NM_011237"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206078 protein sequence
Red=Cloning site Green=Tags(s)

MKCLITGGNVKVLGKAVHSLSRIGDELYLEPLKDGLSLRTVNSSRSAYACFLFAPLFFQQYQAASPGQDL
LRCKILMKAFLSVFRSLAIVEKSVEKCCISLSGSHSHLVVQLHCKYGVKKTHNLSFQDCESLQAVFDPAS
CPHLLRTPARVLAEAVLSFPLALTEVTLGIGRGRRVILRSYQEEEADSTSKAMVTETSIGDEDFQQLHAP
EGIAVTFCLKEFRGLLSFAESANLPLTIHFDVPGRPVIFTIEDSLLDAHFVLATLLEQDSCSQGPCSPKP
HQPVPQKQAHSTPHLDDFTSDDIDCYMIAMETTGGNEGSGAQPSTSLPPVSLASHDLAPTSEEEAEPSTV
PGTPPPKKFRSLFFGSILAPVHSPQGPNPVLAEDSDGEG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035367
Locus ID 19367
UniProt ID Q9Z0F6
Cytogenetics 19 A
RefSeq Size 2046
RefSeq ORF 1167
Synonyms Rad9
Summary Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase. RAD9A possesses 3'->5' double stranded DNA exonuclease activity (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products