2410091C18Rik (BC108350) Mouse Recombinant Protein

CAT#: TP505976

Purified recombinant protein of Mouse RIKEN cDNA 2410091C18 gene (cDNA clone MGC:117993 IMAGE:4220568), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205976 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNALVRRCVARAGLPCIWRGKCYSSGNEPAESNQVTPMLRHLMYKIKSTGPITVAEYMKEVLTNPAKGYY
  VHQDMLGEKGDFITSPEISQIFGELLGVWFVSEWIASGKSPAFQLVELGPGRGTLTADILRVFSQLGSVL
  KTCAISIHLVEVSQKLSEIQALTLAEEKVPLERDAESLVYMKGVTKSGIPISWYRDLKDVPEGYSLYLAH
  EFFDVLPVHKFQKTPRGWREVFVDVDPQASDKLRFVLAPCATPAEAFIQRDERREHVEVCPDAGVIIQEL
  SQRIASTGGAALIADYGHDGTKTDTLRGFYGHQLHDVLIAPGTADLTADVDFSYLHRMAQGKVASLGPVE
  QRTFLKNMGIDVRLKVVVYLSNTKPLNFGNYLN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• Locus ID: 73694
• UniProt ID: Q9CWG8
• Cytogenetics: 17 E3
• Refseq Size: 2640
• Refseq ORF: 1149
• Synonyms: 2410091C18Rik; AL033374; PRO1853
• Summary: Arginine methyltransferase involved in the assembly or stability of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Acts by mediating symmetric dimethylation of 'Arg-118' of NDUFS2 after it assembles into the complex I, stabilizing the early intermediate complex.[UniProtKB/Swiss-Prot Function]