OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B4galt6 (NM_019737) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505973
Purified recombinant protein of Mouse UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6 (B4galt6), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA339432 Rabbit Polyclonal Anti-B4galt6 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "B4galt6 or NM_019737"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205973 protein sequence
Red=Cloning site Green=Tags(s)

MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNK
NTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYLPHLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSE
IGPGGHWRPKDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNV
GFKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKI
NGFPNAFWGWGGEDDDLWNRVHYAGYNVTRPEGDLGKYISIPHHHRGEVQFLGRYKLLRYSKERQYIDGL
NNLLYTPKILVDRLYTNISVNLMPELAPIEDY

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag Myc-DDK
Predicted MW 44.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_062711
Locus ID 56386
UniProt ID Q9WVK5
Cytogenetics 18 A2
RefSeq Size 5808
RefSeq ORF 1146
Synonyms AA536803; AU022389
Summary Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (PubMed:23882130, PubMed:30114188). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation (PubMed:30114188).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "B4galt6" proteins (2)
SKU Description Size Price
LC705973 B4galt6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY705973 Transient overexpression lysate of Mouse UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 6 (B4galt6) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products