OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rccd1 (NM_173445) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505878
Purified recombinant protein of Mouse RCC1 domain containing 1 (Rccd1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rccd1 or NM_173445"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205878 protein sequence
Red=Cloning site Green=Tags(s)

MAEKRHGAWFGFGFCGFGQALGSGNSHHSVYSPEPLHASDDICQVSAGWSYTALVTRGGRVELSGSVSGA
ADGCRDVWASEELLVLLRNKGGASTELQAWVPGSALQGEPLWVQNLVSGAKGQGEDEPSRESRMGTLPLL
PCARAYVTPEPPFCQPLAPELRVRQLELGAEHVLLLCTAGQVFSWGAGRHGQLGHGTLEAELEPRLLEAL
QGLRMAKVAAGGWHSVCLSETGDIYIWGWNESGQLALPTRSGTEKKAEREEATELNEDGLKEELAVADAG
APAHFIAIQPFPALLDLPLGSDAVMASCGSRHTAVVTRTGELYTWGWGKYGQLGHKDSTSLDRPCCVEYF
VERQLEVRAVTCGPWNTYVYAMERDKS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775621
Locus ID 269955
UniProt ID Q8BTU7
Cytogenetics 7 D2
RefSeq Size 2340
RefSeq ORF 1131
Synonyms 5830436H09; E430018M08Rik
Summary Plays a role in transcriptional repression of satellite repeats, possibly by regulating H3K36 methylation levels in centromeric regions together with KDM8. Possibly together with KDM8, is involved in proper mitotic spindle organization and chromosome segregation. Plays a role in regulating alpha-tubulin deacetylation and cytoskeletal microtubule stability, thereby promoting cell migration and TGF-beta-induced epithelial to mesenchymal transition (EMT), potentially through the inhibition of KDM8.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products