Adh1 (NM_007409) Mouse Recombinant Protein

CAT#: TP505820

Purified recombinant protein of Mouse alcohol dehydrogenase 1 (class I) (Adh1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Adh1 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205820 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTAGKVIKCKAAVLWELHKPFTIEDIEVAPPKAHEVRIKMVATGVCRSDDHVVSGTLVTPLPAVLGHEG
  AGIVESVGEGVTCVKPGDKVIPLFSPQCGECRICKHPESNFCSRSDLLMPRGTLREGTSRFSCKGKQIHN
  FISTSTFSQYTVVDDIAVAKIDGASPLDKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVII
  GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYSKPIQEVLQEMTDGGVDFSFEVIGRLDTMTSAL
  LSCHAACGVSVVVGVPPNAQNLSMNPMLLLLGRTWKGAIFGGFKSKDSVPKLVADFMAKKFPLDPLITHV
  LPFEKINEAFDLLRSGKSIRTVLTF
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.8 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_031435
• Locus ID: 11522
• UniProt ID: P00329, Q3UKA4
• Cytogenetics: 3 64.16 cM
• Refseq Size: 1348
• Refseq ORF: 1128
• Synonyms: Adh-1; Adh-1-t; Adh-1e; Adh-1t; Adh-3e; ADH-AA; Adh1-e; Adh1-t; Adh1tl; Adh3-e; AI194826