Aspn (NM_025711) Mouse Recombinant Protein
CAT#: TP505760
Purified recombinant protein of Mouse asporin (Aspn), transcript variant 1,full length with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Frequently bought together (1)
Other products for "Aspn"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205760 protein sequence
Red=Cloning site Green=Tags(s) MKEYVMLLLLAVCSAKPFFSPSHTALKNMMLKDMEDTDDDDNDDDDNSLFPTKEPVNPFFPFDLFPTCPF GCQCYSRVVHCSDLGLTSVPNNIPFDTRMVDLQNNKIKEIKENDFKGLTSLYALILNNNKLTKIHPKTFL TTKKLRRLYLSHNQLSEIPLNLPKSLAELRIHDNKVKKIQKDTFKGMNALHVLEMSANPLENNGIEPGAF EGVTVFHIRIAEAKLTSIPKGLPPTLLELHLDFNKISTVELEDLKRYRELQRLGLGNNRITDIENGTFAN IPRVREIHLEHNKLKKIPSGLQELKYLQIIFLHYNSIAKVGVNDFCPTVPKMKKSLYSAISLFNNPMKYW EIQPATFRCVLGRMSVQLGNVGK myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 42.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079987.2 |
Locus ID | 66695 |
UniProt ID | Q99MQ4, A6H6K1 |
Cytogenetics | 13 A5 |
Refseq Size | 2362 |
Refseq ORF | 1122 |
Synonyms | 4631401G09Rik; AA986886; PL; Plap1; SL; Slrr1c |
Summary | This gene encodes a member of the small leucine-rich proteoglycan family. The encoded protein is an extracellular matrix protein that modulates the transforming growth factor-beta signaling pathway, regulating cartilage matrix gene expression and cartilage formation. The protein plays a role in the pathology of osteoarthritis. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.