Mapt (NM_010838) Mouse Recombinant Protein

CAT#: TP505738

Purified recombinant protein of Mouse microtubule-associated protein tau (Mapt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Mapt was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205738 representing NM_010838
  Red=Cloning site Green=Tags(s)
  
  MADPRQEFDTMEDHAGDYTLLQDQEGDMDHGLKAEEAGIGDTPNQEDQAAGHVTQARVASKDRTGNDEKK
  AKGADGKTGAKIATPRGAASPAQKGTSNATRIPAKTTPSPKTPPGSGEPPKSGERSGYSSPGSPGTPGSR
  SRTPSLPTPPTREPKKVAVVRTPPKSPSASKSRLQTAPVPMPDLKNVGSKIGSTENLKHQPGGGKVQIIN
  KKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDR
  VQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDM
  VDSPQLATLADEVSASLAKQGL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_034968
• Locus ID: 17762
• UniProt ID: P10637, Q547J4, Q3UH19, Q8C5K4
• Cytogenetics: 11 E1
• Refseq Size: 5213
• Refseq ORF: 1116
• Synonyms: AI413597; AW045860; Mtapt; Tau
• Summary: Promotes microtubule assembly and stability, and might be involved in the establishment and maintenance of neuronal polarity. The C-terminus binds axonal microtubules while the N-terminus binds neural plasma membrane components, suggesting that tau functions as a linker protein between both. Axonal polarity is predetermined by tau localization (in the neuronal cell) in the domain of the cell body defined by the centrosome. The short isoforms allow plasticity of the cytoskeleton whereas the longer isoforms may preferentially play a role in its stabilization.[UniProtKB/Swiss-Prot Function]