Rbms1 (NM_020296) Mouse Recombinant Protein

CAT#: TP505707

Purified recombinant protein of Mouse RNA binding motif, single stranded interacting protein 1 (Rbms1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205707 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPPSPSTTSSNNNSSSSSNSGWDQLSKTNLYIRGLPPNTTDQDLVKLCQPYGKIVSTKAILDKATNKCK
  GYGFVDFDSPAAAQKAVSALKANGVQAQMAKQQEQDPTNLYISNLPLSMDEQELENMLKPFGQVISTRVL
  RDSSGASRGVGFARMESTEKCEAVIGHFNGKFIKTPPGVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRP
  WPRDGEAGMTLTYDPTTAALHNGFYPSPYSIATNRMITQTSLTPYIASPVSAYQVQSPSWMQPQPYILQH
  PGAVLTPSMEHTMSLQPASMISPLAQQMSHLSLGSTGTYMPATSAMQGAYLPQYTHMQTAAVPVEEASGQ
  QQVAVETSNDHSPYTFPPNK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064692
• Locus ID: 56878
• UniProt ID: Q91W59, Q3TTX8
• Cytogenetics: 2 C1.2
• Refseq Size: 2688
• Refseq ORF: 1113
• Synonyms: 2600014B10Rik; AI255215; MSSP-1; MSSP-2; MSSP-3; YC1
• Summary: Single-stranded DNA binding protein that interacts with the region upstream of the MYC gene. Binds specifically to the DNA sequence motif 5'-[AT]CT[AT][AT]T-3'. Probably has a role in DNA replication.[UniProtKB/Swiss-Prot Function]