OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Apoa5 (NM_080434) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505662
Purified recombinant protein of Mouse apolipoprotein A-V (Apoa5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Apoa5 or NM_080434"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205662 representing NM_080434
Red=Cloning site Green=Tags(s)

MAAVITWALALLAVFASTQARKSLWDYFSQNSWSKGVMGQPQKLAQENLKGSFEQDLYNMNNYLEKLGPL
RGPGKEPPLLAQDPEGIRKQLQQELGEVSSRLEPYMAAKHQQVGWNLEGLRQQLKPYTAELMEQVGLSVQ
ELQEQLRVVGEDTKAQLLGGVDEALNLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAP
HAAASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSAFIRVSTDGAEDGDSLDPQALSEEVRQ
RLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAY
GLQDQGHSHLSDPEGHSG

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_536682
Locus ID 66113
UniProt ID Q8C7G5
Cytogenetics 9 A5.2
RefSeq Size 2321
RefSeq ORF 1104
Synonyms 1300007O05Rik; Apoav; RAP3
Summary Minor apolipoprotein mainly associated with HDL and to a lesser extent with VLDL. May also be associated with chylomicrons. Important determinant of plasma triglyceride (TG) levels by both being a potent stimulator of apo-CII lipoprotein lipase (LPL) TG hydrolysis and an inhibitor of the hepatic VLDL-TG production rate (without affecting the VLDL-apoB production rate). Activates poorly lecithin:cholesterol acyltransferase (LCAT) and does not enhance efflux of cholesterol from macrophages (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Endocrine and metabolic diseases, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products