Ctns (NM_031251) Mouse Recombinant Protein

CAT#: TP505647

Purified recombinant protein of Mouse cystinosis, nephropathic (Ctns), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205647 representing NM_031251
  Red=Cloning site Green=Tags(s)
  
  MRRNWLLILTLFLLMFIEKYESTVSLTAPPTVKLENGSSTNVDITLGHPLNSTLVITFEVTFRSKNLTIV
  ELPDEVIVPRGEKNASFQVTSQNIGQVTVFLHGNHSNQTCPRIRFLVIHSRIVSIINQVIGWIYFMAWSV
  SFYPQVIQNWRRKSVIGLSFDFLALNLTGFVAYSVFNIGLLWVPYIQEEFLLKYPNGVNPVDSNDAFFSL
  HAVALTLIVILQCCLYERGNQRVSWPSIGFLVLAWLFVLVTMIVAAVGITTWLQFLFCFSYIKLIITLIK
  YFPQAYMNFYYKSTKGWSIGGVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGVFTIFFDVVFF
  IQHFYLYRKKPGYDQLN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112541
• Locus ID: 83429
• UniProt ID: P57757, Q542U5
• Cytogenetics: 11 B4
• Refseq Size: 3010
• Refseq ORF: 1101
• Synonyms: AI195360; AW049661
• Summary: Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR.[UniProtKB/Swiss-Prot Function]