OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Zfp830 (NM_025884) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505578
Purified recombinant protein of Mouse zinc finger protein 830 (Zfp830), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Zfp830 or NM_025884"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205578 protein sequence
Red=Cloning site Green=Tags(s)

MASSTSTRTPAGKRVVNQEELRRLMREKQRLSTNRKRIESPFAKYNRLGQLSCALCNTPVKSELLWQTHV
LGKQHRERVAELKGAKGATQGPSTGTVPQATKRRATDVESQDAKKAKASAGPQVQPSTSASSANLDAARA
APSKPGLGLLPDYDDEEEEEEEGGGEERRDSSKHLPDAQGKEHSLASPRETTSNVLPNDPFNTNPPKAPL
VPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDAKVRKVDAPKDQMDKEWDEFQKAMRQVNTISE
AIVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEVLTIKELQKKEEENVDSDDEGELQD
LLSQDWRVKGALL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_080160
Locus ID 66983
UniProt ID Q8R1N0
Cytogenetics 11 C
RefSeq Size 3278
RefSeq ORF 1089
Synonyms 2410003C20Rik; AV301118; AW048207; Ccdc16; Omcg1; Znf830
Summary May play a role in pre-mRNA splicing as component of the spliceosome (By similarity). Acts as an important regulator of the cell cycle that participates in the maintenance of genome integrity (PubMed:21191184, PubMed:23213458, PubMed:25168238, PubMed:15988037). During cell cycle progression in embryonic fibroblast, prevents replication fork collapse, double-strand break formation and cell cycle checkpoint activation (PubMed:21191184). Controls mitotic cell cycle progression and cell survival in rapidly proliferating intestinal epithelium and embryonic stem cells (PubMed:23213458). During the embryo preimplantation, controls different aspects of M phase (PubMed:15988037). During early oocyte growth, plays a role in oocyte survival by preventing chromosomal breaks formation, activation of TP63 and reduction of transcription (PubMed:25168238).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products