OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Eif4b (BC007171) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505574
Purified recombinant protein of Mouse eukaryotic translation initiation factor 4B (cDNA clone MGC:7530 IMAGE:3492114), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Eif4b or BC007171"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205574 protein sequence
Red=Cloning site Green=Tags(s)

MDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSR
DDYRRDDRGPPQRPRLNLKPRSAPKEDDASASTSQSSRAASIFGGAKPVDTAAREREVEERLQKEQEKLQ
RQLDEPKLDRRPRERHPSWRSEETQERERSRTGSESSQTGASATSGRNTRRRESEKSLENETLNKEEDCH
SPTSKPPKPDQPLKVMPAPPPKENAWVKRSSNPPARSQSSDTEQPSPTSGGGKVAAVQPPEEGPSRKDGN
KVDVVGATQGQAGSCSRGPGDGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV
DGEDEDEGDDCTE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 75705
UniProt ID Q8BGD9
Cytogenetics 15 F2
RefSeq Size 3658
RefSeq ORF 1089
Synonyms 2310046H11Rik; AL024095; C85189; Eif4a2
Summary Required for the binding of mRNA to ribosomes. Functions in close association with EIF4-F and EIF4-A. Binds near the 5'-terminal cap of mRNA in presence of EIF-4F and ATP. Promotes the ATPase activity and the ATP-dependent RNA unwinding activity of both EIF4-A and EIF4-F (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products