Ppm1l (NM_178726) Mouse Recombinant Protein

CAT#: TP505517

Purified recombinant protein of Mouse protein phosphatase 1 (formerly 2C)-like (Ppm1l), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205517 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MIEDTMTLLSLLGRIMRYFLLRPETLFLLCISLALWSYFFHTDEVKTIVKSSRDAVKMVKGKVAEIMQND
  RLGGLDVLEAEFSKTWEFKSHNVAVYSIQGRRDHMEDRFEVLTDLANKTHPSIFGIFDGHGGETAAEYVK
  SRLPEALKQHLQDYEKDKENSVLTYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANV
  GDSRGVLCDKDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIP
  DPDILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVK
  FRNSSKTEEH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 41 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848841
• Locus ID: 242083
• UniProt ID: Q8BHN0
• Cytogenetics: 3 E1
• Refseq Size: 3962
• Refseq ORF: 1083
• Synonyms: 3222401G13; 5930404J21Rik; AI481720; AW045850; mKIAA4175; PP2C; Pp2ce; PP2Cepsilon; Ppp2ce
• Summary: Acts as a suppressor of the SAPK signaling pathways by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5, and by attenuating the association between MAP3K7/TAK1 and MAP2K4 or MAP2K6.[UniProtKB/Swiss-Prot Function]