Lrpap1 (NM_013587) Mouse Recombinant Protein

CAT#: TP505509

Purified recombinant protein of Mouse low density lipoprotein receptor-related protein associated protein 1 (Lrpap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205509 representing NM_013587
  Red=Cloning site Green=Tags(s)
  
  MAPRRERVSTLPRLQLLVLLLLPLMLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRMEKLNQLWEKAK
  RLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDKDGEKEAKLIHNLNVILARYGLDGRKDAQMVHSNA
  LNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFLHYKEKIQEYNVLLDTLSRAEEGYENLLSPS
  DMAHIKSDTLISKHSELKDRLRSINQGLDRLRKVSHQGYGSTTEFEEPRVIDLWDLAQSANFTEKELESF
  REELKHFEAKIEKHNHYQKQLEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSS
  RVSRARHNEL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038615
• Locus ID: 16976
• UniProt ID: P55302, Q52KI7
• Cytogenetics: 5 18.01 cM
• Refseq Size: 2922
• Refseq ORF: 1080
• Synonyms: AA617339; AI790446; AU042172; C77774; HBP44; RAP
• Summary: Molecular chaperone for LDL receptor-related proteins that may regulate their ligand binding activity along the secretory pathway.[UniProtKB/Swiss-Prot Function]