Snapc2 (NM_133968) Mouse Recombinant Protein

CAT#: TP505489

Purified recombinant protein of Mouse small nuclear RNA activating complex, polypeptide 2 (Snapc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205489 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKPPQRRRRVPARYVGEATGPTAWSPREMRHLLRLLQARRGQPEPDAAELAQELRGRSEAEICRFIQQLK
  GRVVREAIQKMQPGGREGPRHQGTPLPAPVEVWMDLAEKLTGPMEEALTAAFSQVLTIAAAEPLSLLHSR
  PGKPTKARGKALVFLSNQDGQKDPASEGSGPVPMTAADPTREASVSDPKASGANPETSGLASEVTVPDPD
  APTKSLAGSSTERDLAVDFEKIYKYLSFSSRGGHGPELSAAESAVVLNLLMALPEELSHLPCTALLEHMT
  KTYAQLMAPQTALPGEKRPRPGTEDGGTGSTGPEEPDQASPQASEPIEPRLAWKAVGICPLNPFLVPLGL
  VSQAPSPSR
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 38.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598729
• Locus ID: 102209
• UniProt ID: Q91XA5
• Cytogenetics: 8 A1.1
• Refseq Size: 1528
• Refseq ORF: 1080
• Synonyms: 0610007H10Rik; AU015675
• Summary: Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box (By similarity).[UniProtKB/Swiss-Prot Function]