OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Gga2 (BC057377) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505395
Purified recombinant protein of Mouse golgi associated, gamma adaptin ear containing, ARF binding protein 2 (cDNA clone MGC:67474 IMAGE:5698559),, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Gga2 or BC057377"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205395 protein sequence
Red=Cloning site Green=Tags(s)

MLSMYRRPGHALPDQQALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQANDLLTQGVRLYKQVVEGR
VSAGNAVPAAVGAIPAPRAFPNPEPCGLNCPLIDLETPSLLHQDLAALGINDVPTRNQVVIPSCCNDKKQ
PGAITLMGGGIQSLSADRNLLDLFSPQPSPGLNYVPQKSIPKEVPPGTKASPGWSWEAGPLASSTASQNT
PLAHVFVPLESVKPSSLPPIVVYDRNGFRILLHFSQTGAPGHPDVKVLLLTMMSTATQPVWDVMFQVAVP
KSMRVKLQPASSSKLPAFSPLMPPAVISQTLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAV
LSTA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 74105
UniProt ID Q6P5E6
Cytogenetics 7 F2
RefSeq Size 2370
RefSeq ORF 1062
Synonyms 1200007E24Rik; mKIAA1080
Summary Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (DXXLL) motif. Mediates export of the GPCR receptor ADRA2B to the cell surface. Regulates retrograde transport of phosphorylated form of BACE1 from endosomes to the trans-Golgi network.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products