OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Eif2b2 (NM_145445) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505324
Purified recombinant protein of Mouse eukaryotic translation initiation factor 2B, subunit 2 beta (Eif2b2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Eif2b2 or NM_145445"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205324 protein sequence
Red=Cloning site Green=Tags(s)

MPGAAAKGSELSERIEGFVETLKRGGGQRSSEDMARETLGLLRRLITDHHWNNAGDLMDLIRREGRRMTA
AQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLSEDFSFHFAPLKANIIEAINEL
LVELEGTMENIAAQALEHIHSNEVIMTIGYSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKE
GIETTVMTDAAIFAVMSRVNKVIIGTKTILANGSLRAVAGTHTLALAAKHHSTPLIVCAPMFKLSPQFPS
EEDSFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPDLITLFISNIGGNAPSYIYRLMSELYHPDDHV
L

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_663420
Locus ID 217715
UniProt ID Q99LD9
Cytogenetics 12 D1
RefSeq Size 1573
RefSeq ORF 1053
Synonyms EIF-2Bbe; EIF-2Bbeta; EIF2; EIF2B
Summary This gene encodes the beta subunit of eukaryotic initiation factor-2B (EIF2B). EIF2B is involved in protein synthesis and exchanges GDP and GTP for its activation and deactivation. Mutations in the human gene are associated with ovarioleukodystrophy and leukoencephalopathy with vanishing white matter. provided by RefSeq, Sep 2015
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products