Sh3gl3 (NM_017400) Mouse Recombinant Protein

CAT#: TP505237

Purified recombinant protein of Mouse SH3-domain GRB2-like 3 (Sh3gl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205237 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVAGLKKQFHKASQLFSEKISGAEGTKLDEEFLNMEKKIDITSKAVAEILSKATEYLQPNPAYRAKLGM
  LNTVSKLRGQVKATGYPQTEGLLGDCMLKYGKELGEDSAFGNSLVDVGEALKLMAEVKDSLDINVKQTFI
  DPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEKFEESKELAERSMFNFLENDVE
  QVSQLAVFVEAALDYHRQSTEILQELQSKLELRISLASKVPKREFMPKPVNMSSTDANGVGPSSSSKTPG
  TDTPSDQPCCRGLYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLRGESGFFPINYVEVIVPLPP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_059096
• Locus ID: 20408
• UniProt ID: Q62421, A0A0R4J0B8
• Cytogenetics: 7 47.15 cM
• Refseq Size: 1648
• Refseq ORF: 1044
• Synonyms: EEN-B2; Sh3d2c; Sh3d2c2; SH3P13
• Summary: Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).[UniProtKB/Swiss-Prot Function]