Marc2 (NM_133684) Mouse Recombinant Protein

CAT#: TP505031

Purified recombinant protein of Mouse mitochondrial amidoxime reducing component 2 (Marc2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Marc2 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205031 representing NM_133684
  Red=Cloning site Green=Tags(s)
  
  MGSSSSTALARLGLPGQPRSTWLGVAALGLAAVALGTVAWRRTRPRRRRQLQQVGTVSKVWIYPIKSCKG
  VSVCETECTDMGLRCGKVRDRFWMVVKEDGHMVTARQEPRLVLVSITLENNYLTLEAPGMEQIVLPIKLP
  SSNKIHNCRLFGLDIKGRDCGDEVAQWFTNYLKTQAYRLVQFDTSMKGRTTKKLYPSESYLQNYEVAYPD
  CSPVHLISEASLVDLNTRLKKKVKMEYFRPNIVVSGCEAFEEDTWDELLIGDVEMKRVLSCPRCVLTTVD
  PDTGIIDRKEPLETLKSYRLCDPSVKSIYQSSPLFGMYFSVEKLGSLRVGDPVYRMVD
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 38.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598445
• Locus ID: 67247
• UniProt ID: Q922Q1
• Cytogenetics: 1 H5
• Refseq Size: 1883
• Refseq ORF: 1014
• Synonyms: 2810484M10Rik; mARC1; Mosc2
• Summary: As a component of the benzamidoxime prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively (By similarity).[UniProtKB/Swiss-Prot Function]