Angptl7 (NM_001039554) Mouse Recombinant Protein

CAT#: TP505028

Purified recombinant protein of Mouse angiopoietin-like 7 (Angptl7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205028 representing NM_001039554
  Red=Cloning site Green=Tags(s)
  
  MLRETWLCVILVAFVSHPVWLQKPHKRKTQLKAAGCCEEMRELKAQVANLSSLLGELSRKQESDWVSVVM
  QVMELESSSKHMESRLSTAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPP
  DEFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYQDWRQYKQGFGSIRGDFWLGNEHIHRLTRQPSRL
  RVELEDWEGNARYAEYSYFALGNELNSYRLFLGNYSGNVGKDALLYHNNTVFSTKDKDNDNCLDKCAQLR
  KGGYWYNCCTDSNLNGVYYRLGEHRKHMDGISWYGWHGANYSLKRVEMKIRPEAFKP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001034643
• Locus ID: 654812
• UniProt ID: Q8R1Q3
• Cytogenetics: 4 E2
• Refseq Size: 2063
• Refseq ORF: 1011
• Summary: Has a role in the formation and organization of the extracellular matrix. In the eye, it functions as a mediator of dexamethasone-induced matrix deposition in the trabecular meshwork, the tissue responsible for the outflow of the ocular aqueous humor and for the maintenance of intraocular pressure (By similarity). Is a negative regulator of angiogenesis in the cornea, and plays a major role in maintaining corneal avascularity and transparency (PubMed:25622036).[UniProtKB/Swiss-Prot Function]