Mat2b (NM_134017) Mouse Recombinant Protein

CAT#: TP504961

Purified recombinant protein of Mouse methionine adenosyltransferase II, beta (Mat2b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR204961 representing NM_134017
  Red=Cloning site Green=Tags(s)
  
  MVGREKELSIHFVPGCCQLVEEEVNIPSRRVLITGATGLLGRAVYKEFQQSNWHTVGCGFRRARPKFEQV
  NLLDSEAVHHLIHDFQPHVIVHCAAERRPDVVESQPDAASQLNVGASGNLAKEAAAIGAFLIYISSDYVF
  DGTNPPYTEEDIPSPLNLYGKTKLDGEKAVLENNLGAAVLRIPVLYGEVEKLEESAVTVMFDKVQFSNKS
  ANMDHWQQRFPTHVKDVASVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFNLPSSHLRPIT
  DSPVIGAQRPKNAQLDCSKLETLGIGQRTPFRTGIKESLWPFLIDKRWRQTVFH
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 37.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598778
• Locus ID: 108645
• UniProt ID: Q99LB6
• Cytogenetics: 11 A5
• Refseq Size: 1870
• Refseq ORF: 1002
• Synonyms: 1110064C04Rik; 2410018D16Rik; AI182287; AU022853; MAT-II; MATIIbeta; TGR
• Summary: Regulatory subunit of S-adenosylmethionine synthetase 2, an enzyme that catalyzes the formation of S-adenosylmethionine from methionine and ATP. Regulates MAT2A catalytic activity by changing its kinetic properties, increasing its affinity for L-methionine. Can bind NADP (in vitro).[UniProtKB/Swiss-Prot Function]